SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3XSY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XSY8
Domain Number 1 Region: 80-184
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-25
Family SH2 domain 0.0000333
Further Details:      
 
Domain Number 2 Region: 1-41
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000198
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XSY8
Sequence length 300
Comment (tr|M3XSY8|M3XSY8_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000002188} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMAELRECTGQGLENTDPETHTPSAPESGT
SNSPRGSTDSLNQGASPGGMPDPACQKTDHFLSCYPWFHGPISRVKAAQLVQLQGPDAHG
VFLVRQSETRRGEYVLTFNFQGIAKHLRLSLTERGQCRVQHLHFPSVVDMLHHFQRSPIP
LECGAACDVRLSSYVVVVSQPPGSSNTVLFPFSLAHWDSELGLPHLSSSGCPRGHGLEGP
PSRPSPPEQIFHLLPSPEELENSLRHLEPEAASRARDSDYEMDSSSRSHLRAIDNQYTPL
Download sequence
Identical sequences M3XSY8
ENSMPUP00000002188 ENSMPUP00000002188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]