SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3XWX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XWX6
Domain Number 1 Region: 12-112
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-27
Family SH2 domain 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XWX6
Sequence length 143
Comment (tr|M3XWX6|M3XWX6_MUSPF) SH2 domain containing 1B {ECO:0000313|Ensembl:ENSMPUP00000003576} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SH2D1B OC=Mustelinae; Mustela.
Sequence
MDYRAPSRLAVDLPYYHGPLSKKDCETLLLQDRVDGNFLIRDSESVPGVLCLCVSFKNFV
YTYRIFKDGRGFYNIQTVEGAPQMLFSNLKELISTFEKPNQGLVVQLRHPIKQASSRPRW
RRSQIQLDSIYENSNSDYVEVLP
Download sequence
Identical sequences M3XWX6
XP_004751467.1.14098 ENSMPUP00000003576 ENSMPUP00000003576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]