SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3Y0M6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y0M6
Domain Number 1 Region: 391-595
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y0M6
Sequence length 747
Comment (tr|M3Y0M6|M3Y0M6_MUSPF) Rho GTPase activating protein 28 {ECO:0000313|Ensembl:ENSMPUP00000004877} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ARHGAP28 OC=Mustelinae; Mustela.
Sequence
MLVSAFVLGPERGHAPLRMEVEDSGGVVLTAYHSYARSQPPSSEPRCAPRATASHPGSRK
SIPRCRRINRMLSNESLHSPAFSRSNSQASIDSTSMEEFLREIESIKENSMGGQEEQLPA
EVKPVDEGELEAEWLQDVGLSTLISGNEEEDGKALLSTLTRTQAAAVKKRYNTYTQTMRK
KNKQSVRDVRDIFGVSESPPGDTCDNHTAQLDGTLEEKELPGIIKTSGSLPDGASLNNTT
LSDGSQDEEGGFAVPRSGSVSVLEPLPALPVLSNGSPDPAQAVQNAGSDDDYRKKNIPPE
TEELSFEVSYSEMVTEAPKRSKFKKSDFKKEDYALTKFIVQKTRFGLTEAGDLSAEDMKK
VRHLSLIELTAFFDAFGIQLKRNKTERVKGRDNGIFGVPLTVLLDNDRKKDPGVKVPLVL
QKFFEKVEESGLESEGIFRLSGCTAKVKQYREELDAKFNADKFKWDRMCHREAAVMLKAF
FRELPTSLFPVEYIPAFITLIERGPHIKVQFQALHLMIMALPDANRDTAQALMTFFNKVI
ANESKNRMSIWNISTIMAPNLFFSRSKHSDYEELQLANTAAHIIRLMLKYQKILWKVPSF
LITQVRRMNEATMLLKKQLPSVKKLLRRKTIEREVISPKTSKVLQKSPSSRRMSDVPEGV
IRVHAPLLSKVSMAIQLTSHTKAKDILAKFQYENSHGSSECFKIQNQRLYEIGGNIGQHC
LDPDAYILDIYHVNPQAEWVIKPQPSF
Download sequence
Identical sequences M3Y0M6
ENSMPUP00000004877 ENSMPUP00000004877 XP_004742791.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]