SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3Y0N2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y0N2
Domain Number 1 Region: 274-419,446-494
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.26e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000105
Further Details:      
 
Domain Number 2 Region: 24-160
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-26
Family SH2 domain 0.000000109
Further Details:      
 
Domain Number 3 Region: 204-268
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.08e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y0N2
Sequence length 494
Comment (tr|M3Y0N2|M3Y0N2_MUSPF) Chimerin 2 {ECO:0000313|Ensembl:ENSMPUP00000004883} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CHN2 OC=Mustelinae; Mustela.
Sequence
MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICAGEVENRPKYYGREF
HGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFYDGKHFVGEKRF
ESIHDLVTDGLITLYIETKASEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNESRKT
SVTNEEHTTVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIA
QGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIRE
IEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLP
IPVITYDTYPKFIEAAKISNADERLEAVHDVLMLLPPAHYETLRYLMIHLKNSTTNIQKT
SIPENKNLGDCNFIPLGRVTLNEKDNLMNAENLGIVFGPTLMRSPEDSTLTTLHDMRYQK
LIVQILIENEDVLF
Download sequence
Identical sequences M3Y0N2
ENSMPUP00000004883 ENSMPUP00000004883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]