SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3Y1H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y1H1
Domain Number 1 Region: 279-551
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-84
Family Protein kinases, catalytic subunit 0.000000000266
Further Details:      
 
Domain Number 2 Region: 168-308
Classification Level Classification E-value
Superfamily SH2 domain 5.79e-38
Family SH2 domain 0.00000248
Further Details:      
 
Domain Number 3 Region: 108-193
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-20
Family SH3-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y1H1
Sequence length 1079
Comment (tr|M3Y1H1|M3Y1H1_MUSPF) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ABL2 OC=Mustelinae; Mustela.
Sequence
MGQQVGRVGEAPGLQQPQPRGIRVSSAARPSGRRRDLAGRTTEAGFNIFTQHDHFASCVE
DGFEGDKTGGSSPEALHRPYSCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVA
SGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSR
SAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTTDGKVYVTAESRFST
LAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYG
EVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIV
TEYMPYGNLLDYLRECSREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGEN
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIAT
YGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFE
TMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE
NSASSSAPGFLRGAQAPTGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKR
NAPTPPKRSSSFREMENQPHKKYELTGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPE
ENVDRANDMLPKKSEEGAAPSRERPKAKLLPRGAAALPLRTPSGDPAITEKDSPGAGVAG
VAAAPKSKERNGGARLGMAGVPEDGDQTGWSSPAKAAAALPTTHNHKVPVLISPTLKHTP
ADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSLCSDPT
EEPTASTAGQPALETQDGGKKAAPGAVPGGGKAGRPVMPPPQVPLPTSSISPAKMANGTA
GTKVALRKTKQAAEKISADKISKEALLECADLLSSAITEPVPNSQLVDTGHQLLDYCSGY
VDCIPQTRNKFAFREAVSKLELSLQELQVSSAAAGVPGANPVLNNLLSCVQEISDVVQR
Download sequence
Identical sequences M3Y1H1
ENSMPUP00000005172 ENSMPUP00000005172 XP_004762054.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]