SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3Y6K5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y6K5
Domain Number 1 Region: 5-291
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-74
Family BAR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 398-576
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.000000313
Further Details:      
 
Domain Number 3 Region: 264-368
Classification Level Classification E-value
Superfamily PH domain-like 8.58e-16
Family Pleckstrin-homology domain (PH domain) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y6K5
Sequence length 753
Comment (tr|M3Y6K5|M3Y6K5_MUSPF) Rho GTPase activating protein 10 {ECO:0000313|Ensembl:ENSMPUP00000006956} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ARHGAP10 OC=Mustelinae; Mustela.
Sequence
MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLIAATKSLSAAQRKF
AHSLRDFKFEFIGDAETDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFR
KEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQEADIQVEQNRQHFYELSLE
YVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINIQNTRNRFE
GTRSEVEELMNKIRQNPKDHKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCMYRKAAKKF
NIIPFEHRSGGKLGDGEVFFLKECTKRHTDSIDRRFCFDVEAADRPGAALTMQAFSEEER
KQWLEALGGKEALLHSFNRAIIPRPEGSAQLDKMGLTILRKCISAVETRGINDQGLYRVV
GVSSKVQRLLSMLMDVKTCNEVDLENSIDWEVKTITSALKQYLRSLPEPLMTYELHGDFI
VPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGP
TLMRPQEETVAAIMDLKFQNIVVEILIENHEKIFRTLPDATFPEPVSLSTSPPNAPPRQS
KRQGQRTKRPVAVYNLCLELEDGDSVNLPKADTTAGNLDSLSSPSPTIAAVPGPLGPDKN
HLADGSSFGDWTSSVPCQTRSPMVQWLNTQSPTTPSCSPAVTPPSPKPPPSPLSLPAAIV
DKPPERYGEWRMMSKTGAAPRPDQPEQLFVFPT
Download sequence
Identical sequences M3Y6K5
ENSMPUP00000006956 ENSMPUP00000006956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]