SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3Y7H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y7H3
Domain Number 1 Region: 320-445
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-25
Family SH2 domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y7H3
Sequence length 449
Comment (tr|M3Y7H3|M3Y7H3_MUSPF) Src homology 2 domain containing E {ECO:0000313|Ensembl:ENSMPUP00000007280} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SHE OC=Mustelinae; Mustela.
Sequence
MAARWFKEFPLNLKTASERARPGGGGGRLRKNSEAGGAGPAPAKGRKNSAAELGSGRAGV
GAPRDSRPPRDSLQGLIQAAAGKSRKNSRAAEDEPPRGAARSAGCGTYISRLIKVDTQEK
NGRGSSSSSSSSSSSASSSPASLGPELDKGRPGKQPDTVIILEDYADPYDAKRTRGQRDA
ERAGENDGYMEPYDAQQMITEIRRRGSKDPVVKALQLLDGPCESGENSAKAETAAKRRGS
KELVGKPPQLYDTPYEPPDGAPERRARLPAEDERPAAEYEQPWEWKKEQLARALSVQFEG
SDWPSVKEDPAKQQQRQKSWTQKVLKPVGPDHGEGEKVAPGLPLGKQPWYHGAITRAEAE
SRLQPCREAAYLVRNSESGNSKYSIALKTSQGCVHIIVAQTKDSKYTLDQTSAVFDSIPE
VVHYYSNEKLPFKGAEHMTLLYPVHSKGH
Download sequence
Identical sequences M3Y7H3
XP_004780368.1.14098 ENSMPUP00000007280 ENSMPUP00000007280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]