SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3YA22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YA22
Domain Number 1 Region: 230-334
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.23e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 88-191
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000262
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.054
Further Details:      
 
Domain Number 3 Region: 5-52
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000811
Family HLH, helix-loop-helix DNA-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YA22
Sequence length 551
Comment (tr|M3YA22|M3YA22_MUSPF) Single-minded family bHLH transcription factor 2 {ECO:0000313|Ensembl:ENSMPUP00000008179} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SIM2 OC=Mustelinae; Mustela.
Sequence
MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGL
GDAWGQPSRAGPLDSVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPSDHDEMTAVLAAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGY
KVIHCSGYLKIRQYMLDMSLYDSCYQIVGLVAVGQSLPPSAVTEIKLHSNMFMFRASLDL
KLIFLDSRVTELTGYEPQDLIEKTLYHHVHGCDVFHLRYAHHLLLVKGQVTTKYYRLLSK
LGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTEIEYKELQLSLDQVSTSKCQDSWRTAL
STSQETRKLAKPKNTKMKTKLRTNPYPPQQYSSFQMDKLECSQLGNWRASPPANAPAPPE
QQLHSESSDLLYAPSYSLPFSYRYGHFPLDSHVFSSKKPMLPAKFGQPQASPCEVARFFL
STLPASGECQWHYANPLVPSSPTPAKSLSEPPVNAARHSLVPNYEDYSPTAPKNEYGTPL
VCFPSQFSKCG
Download sequence
Identical sequences M3YA22
ENSMPUP00000008179 ENSMPUP00000008179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]