SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3YA94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YA94
Domain Number 1 Region: 176-434
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-56
Family Protein kinases, catalytic subunit 0.00000128
Further Details:      
 
Domain Number 2 Region: 74-209
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-22
Family SH2 domain 0.0000468
Further Details:      
 
Domain Number 3 Region: 8-94
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000122
Family SH3-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YA94
Sequence length 444
Comment (tr|M3YA94|M3YA94_MUSPF) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PTK6 OC=Mustelinae; Mustela.
Sequence
AASWDQAPLGPQHVGLWDFEARRDEERTFRAGHLFHVAGKEGRRWRAAPLDAEGRPLTEG
CMPHNYLAEKETVESELWFFGPISRLEAQHCLQAEGSVAASLVRVGQKPGADYSLSVRDR
QAMRHYRVWCRAGRLHLSEAASYPSLAELLGHHKGRSLSHGLPRTVPCRKPEPEPPPHWA
DWQRPHEEFRLCRKLGSGYFGGVFEGIWKDRVQVAIKVIARDNLLHQHTFQAEIQATKKL
QHKHILVLCAAASVGDPYIVPELLAKGSLLELLRDSEKSLPVSELVDIASQVAEGMCYLQ
SQNYVHRDLATRNILVGAHNICKVGDFGLARFIQDEREAAHGQGRPGRWHRPSKCSYGHT
DVRSFRILHQETFSRGSIPYPGTSRHEAFQRVESGYRMPCPPERPAAAAHKLMLSCWHRD
PEHRPCFQAVPEKLSSVSTYENPL
Download sequence
Identical sequences M3YA94
ENSMPUP00000008251 ENSMPUP00000008251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]