SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3YDZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YDZ6
Domain Number 1 Region: 27-489
Classification Level Classification E-value
Superfamily Sema domain 2.62e-125
Family Sema domain 0.0000463
Further Details:      
 
Domain Number 2 Region: 1330-1458,1653-1842
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-51
Family p120GAP domain-like 0.022
Further Details:      
 
Domain Number 3 Region: 1020-1125
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000194
Family Other IPT/TIG domains 0.084
Further Details:      
 
Domain Number 4 Region: 838-935
Classification Level Classification E-value
Superfamily E set domains 0.000000000000312
Family Other IPT/TIG domains 0.018
Further Details:      
 
Domain Number 5 Region: 933-1022
Classification Level Classification E-value
Superfamily E set domains 0.00000000000128
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 6 Region: 492-542
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000102
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 7 Region: 1123-1202
Classification Level Classification E-value
Superfamily E set domains 0.00000196
Family Other IPT/TIG domains 0.079
Further Details:      
 
Weak hits

Sequence:  M3YDZ6
Domain Number - Region: 790-824
Classification Level Classification E-value
Superfamily Plexin repeat 0.000314
Family Plexin repeat 0.0034
Further Details:      
 
Domain Number - Region: 637-672
Classification Level Classification E-value
Superfamily Plexin repeat 0.0549
Family Plexin repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YDZ6
Sequence length 1872
Comment (tr|M3YDZ6|M3YDZ6_MUSPF) Plexin A3 {ECO:0000313|Ensembl:ENSMPUP00000009553} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PLXNA3 OC=Mustelinae; Mustela.
Sequence
MPAVGLLLLFLPAVVGAVGGSRTFPAFLVTDTTLTHLAVHRVTGEVFVGAVNRVFKLAPN
LTELRAHVTGPVEDNARCYPPPSMRACAHRLAPADNVNKLLLVDYAARRLVACGSVWQGV
CQFLRLDDLFKLGEPHHRKEHYLSGAQEPDSMAGVIVEQDQGPSKLFVGTAVDGKSEYFP
TLSSRKLISDEDSSDMFSLVYQDEFVSSQIKIPSDTLSSYPAFDIYYIYGFVSASFVYFL
TLQLDTQQTLLDVAGEKFFTSKIVRMCAGDSEFYSYVEFPIGCSWRGVEYRLVQSAHLAK
PGLLLAQALGVPPDEDVLFTVFSQGQKNRASPPRQTVLCLFTLSTINAHIRRRIQSCYRG
EGTLALPWLLNKELPCINTPMQINGNFCGLVLNQPLGGLHVIEGLPLLADSSDGMASVAA
YTYRQHSVVFIGTRTGSLKKVRVDGSQYAHLYETVPVVDGSPILRDLLFSPDHRHIYLLS
EKQVSQLPVETCEQYGSCAACLGSGDPHCGWCVLQHRCCREGACPGASAPHGFAEELSKC
VQVQVRPNNVSVTSPGVQLTVAMRNVPDLSVGVSCAFEEVTESEAVPLPSGELRCPSPSL
QELRALTRGHGATRTVRLQLLSRETGVKFAGVDFVFYNCSALQSCVSCVGSPYPCHWCKY
RHVCTSHPHECSFQEGRVHSPEGCPEILPSGDLLIPVGVMQPLTLRAKNLPQPQSGQKNY
ECVVRVQGRQQRVPAVRFNSSSVQCQNASYSYDGDEYGDTELDFSVVWDGDFPIDKPATF
RALLYKCWAQRPSCGLCLKADPRFNCGWCISEHRCQLRAHCPAPKTNWMHPSQKGTRCSH
PRIAQIHPLMGPKEGGTRVTIVGENLGLSYREVSLRVAGVRCNSIPSEYISAERIVCEME
ESLVPSPPPGPAELCVGDCSADFRTQSEQLYSFVTPAFDRVSPSRGPASGGTRLTISGSS
LDAGSRVTVTVRDGECQFVRRDAEAIVCISPVSTLGPSQAPITLAIDRANISSPGVLYTY
TQDPTVTRLEPTWSIINGSTAITVSGTHLLTVQEPRVRAKYRGIETTNTCQVINDTAMLC
KAPGIFLGRPQPQAQGEHPDEFGFLLDHVQTARSLNRSSFTYYPDPSFEPLGPSGVLDVK
PGSHVVLKGKNLIPAAAGTSRLNYTVLIGGQPCALTVSDTQLLCDSPRQTGRQPVMVLVG
GLEFWLGTLHITAERALTLPAMVGLAAGGGLLLLAITAVLVAYKRKTQDADRTLKRLQLQ
MDNLESRVALECKEAFAELQTDINELTSHMDGVQIPFLDYRTYAVRVLFPGIEAHPVLKE
LDTPPHVEKALRLFGQLLHSRAFVLTFIHTLEAQSSFSMRDRGTVASLTMVVLQSRLDYA
TGLLKQLLADLIEKNLESRNHPKLLLRRTESVAEKMLTNWFTFLLHKFLKECAGEPLFLL
YCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCLFPESEGSTQVPVKVLN
CDSITQAKDKLLDAVYKGIPYSQRPRAEDMDLEWRQGRMARIILQDEDVTTKIECDWKRV
NSLAHYQVTDGSLVALVPKQVSAYNMANSFTFTRSLSRYESLLRTASSPDSLRSRAPMIT
PDQETGTKLWHLVKNHDHADHREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETVFST
AHRGSALPLAIKYMFDFLDEQADQRQISDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH
KSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYRDIAKMA
SISDQDMDAYLVEQSRLHASDFNILSALSELYFYVTKYRQEVLTALDRDASCRKHKLRQK
LEQIISLVSSNS
Download sequence
Identical sequences M3YDZ6
ENSMPUP00000009553 XP_004780793.1.14098 ENSMPUP00000009553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]