SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3YED4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YED4
Domain Number 1 Region: 18-212
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.87e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YED4
Sequence length 971
Comment (tr|M3YED4|M3YED4_MUSPF) Family with sequence similarity 13 member B {ECO:0000313|Ensembl:ENSMPUP00000009691} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=FAM13B OC=Mustelinae; Mustela.
Sequence
MRKSSSPSLSNCNSVLANKIFGIPLDELQQGGHPDNEVPFIVRHVVDYIEEHGGLEQQGL
FQVNGNAETVEWLRQRYDSGEEVDLVKEADVPSAISLLRFFLQELPEPVIPGSLHIHLMQ
LSQDYNNEDEFGRKLRFLLQQLPPVNYSLLKFLCRFLANVASHHEEIWSANSLAAVFGPD
VFHIYTDVEDLKEQEIVSRIMAGLLENYYEFFENEEEDFSSNDLSSITEQAGSSVLHKLE
SGEQAFHEALEKGITAVKERRDVNELSEEEEEDEKLEHIEELPEEGAEKSSDMAEVVQLR
MTENILEPSSVTASTSAHLSPISILPASADILERTIRAAVEQHLFDLQSSIDHDLKNLQQ
QSLVCNNEAESFNCDGEGSNNQVDIADDIINASESNRDCSEPVASTNLDNEVMQQDFVFE
DEENSQSVGILLEPCSDRGDSEDGCLEGKEYVSFDSDTLSHLILDSSSKICDLNANTESE
VPGGQSVGVQGEAACGTQIPHLDLKNVSDGDKWEASCPITFPLIDFKTMHLQRDGEEPFP
AFKSWQEDSESGEAQLSPQAGRMNHHPLEEDCPPVLSHRSLDFGQSQRFLHDPETLDSSS
KALSFTRIRRSSFSSKDEKREDRTPYQLVKKLQKKIRQFEEQFERERNSKPSYSDIAANP
KVLKWMTELTKLRKQIKDAKHKSSDGEFVPQTRPRSNTLPKSFGSSLYHEDEENEDESRV
IQKEKKPSKEATLELILKRLKEKRVERCLPEDIKKMTKDHLIEEKTSLQKSLLYYESQHG
RPVTREERHIVKPLYERYRLVKQMLTRVSITPVLGSPSSKRRGQMLQPIIEGETAHFFEE
IKEEEEDGVTLSSELTDILKTAVQAQSSLENSESDVEENQEKLALDLRLSSTRAASMPEL
LEQLWKARAEKKKLRKTLREFEEAFYQQNGRNAQKEDRVPVLEEYKEYKKIKAKLRLLEV
LISKQDSSKSI
Download sequence
Identical sequences M3YED4
XP_004744952.1.14098 ENSMPUP00000009691 ENSMPUP00000009691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]