SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3YH00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YH00
Domain Number 1 Region: 691-837
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.05e-39
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 1017-1117
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.09e-30
Family Ras-binding domain, RBD 0.00077
Further Details:      
 
Domain Number 3 Region: 215-372
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-20
Family Phosphotyrosine-binding domain (PTB) 0.0097
Further Details:      
 
Domain Number 4 Region: 12-98
Classification Level Classification E-value
Superfamily PDZ domain-like 1.25e-19
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 962-1031
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000284
Family Ras-binding domain, RBD 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YH00
Sequence length 1421
Comment (tr|M3YH00|M3YH00_MUSPF) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSMPUP00000010607} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=RGS12 OC=Mustelinae; Mustela.
Sequence
MYRAGDMVDRPLHGPAPPRLRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIGEGLGHLESCSSDEEIGFYDGKGWL
KPKLDSKALGINRAERVVEEMQSGGIFSMIFENPSLRTSTSEPLKLKQRSLSESAAARFD
LGRESVSHPNSSLLSKEEVSKVINDDSVFSIGPENHEDFALDASILNVAMVVGYLGSIEL
PSTSCNLESDSLQAIRGCLRRLRAEQKIHSLVTMRVLHDRVQLCTDQAAVLAEYPAEKLA
FSAVCPDDRRLFGLVTMQSGDDGSLAHEDEGALRTSCHVFMVDPDLFSHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGVRARAFADGDADAQQNASTSS
NSDSGIGNFHQEERSSRVLVLDLGASSSRHSPGNGGWEGMGGRGSQPWGTPWNGAFCHDT
EVGGPFEVAPPADRGRDFSKHLGPAAHAEVPPASLRSSVPPSKRGAAGHGGGLGQRWLPV
HVLQEWQCGHASDQESYTDSTDGWSSINCGTLPPPMSKIPADRYRLEGSLAQLPLGAQKR
DWSRKAFGMQNIFGPHRQVRKAKEDKKGSKFGRAIGLTQTSQRTSARRSFGRSKRFSITR
SLDDLESATVSDGELTGTDLKDCVSNHSLSSNASLPSVQSCRRLRERRAASWAVSFERLL
QDPLGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATT
PVNIDSQAQLADDILSAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQLYQECILAEVEGRS
LPDAQQVPSSPASKHSVSSEHSSVSTPKKLSGKSKSGRSLNEELGDEDSEKKRKGAFFSW
SRTRSTGRSQKKKEHGDHANEPPHANGGLGRRESQGSVSSTGSLDLSEACRTSGPERDKA
AKHCCIQLPDGTSCVVAVKAGLSIKEVLAGLCERHGINGAAVDLFLVGGDKPLVLHQDSS
ILESRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLHLNELVARLSG
EKEPLDLGAPISSLDGQRVILEEKEPSRGKEKQKSTPTRQNTAVNSSSRNHSATGEERTL
GKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSNRAD
DQRGLLRKEDLVLPEFLRLPPGPVERTLPSPTAAKSFGKRSLTSNGKDKAPWPSATSPTT
SPATSPATSPTTSPTTSPSSAGSPPFSAPQTPSPHSQEAEAGGVQTMEGEHVADLTLTGE
GDISSPNSTLLPPTPTPRDSAGPPRPGGGARGSQGLPVNTIIDVDRVAGLAPGLGGSVPG
VRVCPQRSRTSGALTSDLPSLSPFPGAPAKPKASPHHATFV
Download sequence
Identical sequences M3YH00
XP_012901266.1.14098 XP_012901267.1.14098 ENSMPUP00000010607 ENSMPUP00000010607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]