SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3YHM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YHM1
Domain Number 1 Region: 25-506
Classification Level Classification E-value
Superfamily ALDH-like 3.93e-182
Family ALDH-like 0.00000000000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YHM1
Sequence length 512
Comment (tr|M3YHM1|M3YHM1_MUSPF) Aldehyde dehydrogenase 1 family member A3 {ECO:0000313|Ensembl:ENSMPUP00000010828} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ALDH1A3 OC=Mustelinae; Mustela.
Sequence
MATTNGAVENGQPDRKPPALPRPVRNLEVKFTQIFINNEWHESKSGKKFATYNPSTLEKI
CEVEEGDKPDVDKAVEAAHAAFQRGSPWRRLDALGRGWLLHQLADLVERDRAVLATLETM
DTGKPFLHAFFIDLEGCIKTLRYFAGWADKIQGRTIPTDDNVVCFTRHEPIGVCGAITPW
NFPLLMLVWKLAPAICCGNTIVVKPAEQTPLTALYLGSLIKEVGFPPGVVNIVPGFGPTV
GAAISSHPQISKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGVFFNQGQCCTAASRVFVEEQIYAEFVKRSVEHAKKRLVGDPFDVRTEQGPQIDQK
QFDKILDLIESGKKEGAKLECGGSAMEDRGLFIKPTVFSEVTDTMRIAKEEIFGPVQPIL
KFKNIEEVIKRANSLEYGLTAAVFTKNLDKALKLASALESGTVWINCYNAIYAQAPFGGF
KMSGNGRELGEYALAEYTEVKTVTIKLDDKSP
Download sequence
Identical sequences M3YHM1
ENSMPUP00000010828 ENSMPUP00000010828 XP_004759897.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]