SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3YKN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YKN4
Domain Number 1 Region: 522-554,658-733
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000502
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YKN4
Sequence length 790
Comment (tr|M3YKN4|M3YKN4_MUSPF) Anion transporter/exchanger protein 9 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SLC26A9 OC=Mustelinae; Mustela.
Sequence
MSQPRPRYVVDRAVYSLTVLDDEFEKKDRTYPLGEKLRHAFRCSSAKTKAVVFGLLPVLS
WLPKYKIKDYIIPDLLGGLSGGSIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGI
HQMVPGTFAVISILVGNICLQLAPESKFWVFDNATNKSYVDTAAMEAERLHVSATLACLT
AIIQMGLGFVQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTIPSYAGPGSIIFT
FIDICKNLPHTNIASLIFALISGVFLVLVKELNARYMHRIRFPIPTEMIVVVVATAISGG
CKMPQKYHMQIVGEIQHGFPTPVLPVVSQWKDMMGTAFSLAIVGYVINLAMGRTLASKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGSYLYPLPKSVLGALIAVNLKNSLRQLADPYYLWKKSKLDCCVWMVSFLSSFFLSLPY
GVAVGVAFSALVVVFQTQFRNGYALAQVMDTDIYVNPKTYNRVQEIEGVKIVTYCSPLYF
ANSEIFRQKVIAKTGVDPQKVLLAKQKYLRRQEKGRLRPTQQRKSLFMKTKTVSLQELQQ
DFENASPTDPNNNQTPANGASVSYITFSPDSSPAAHCEPPASAETPSEPSDMLASVPPFV
TFHTIILDMSGVSFVDLMGIKTLGKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGC
LERDHIFPSIHDAVLFAQANAREVVPGRDFQGAPVDPELSLYDLEDSPSYWDLEQEMFGS
MFHTETLTAL
Download sequence
Identical sequences M3YKN4
ENSMPUP00000011891 ENSMPUP00000011891 XP_012913694.1.14098 XP_012913695.1.14098 XP_012913696.1.14098 XP_012913697.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]