SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3YKU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YKU9
Domain Number 1 Region: 389-683
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.98e-56
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Domain Number 2 Region: 61-313
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.11e-34
Family WD40-repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YKU9
Sequence length 1307
Comment (tr|M3YKU9|M3YKU9_MUSPF) WD repeat domain 17 {ECO:0000313|Ensembl:ENSMPUP00000011956} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=WDR17 OC=Mustelinae; Mustela.
Sequence
MAWMTYISNWFEQDDWYEGLQRANMSQVRQVGLLAAGCQPWHKDVCAANGDRFAYCATLA
IYIYQLDHRYNEFKLHAIMSEHKKTITAISWCPHNPDVFASGSTDNLVIIWNVAEQKVLA
KLDNTKGTPASLSWCWNAGDAVAFVSHRGPLFIWTISGPESGVTVHKEAHSFLSDVCVFR
WHTQKKGKIVFGHIDGSLSIFQPGNKSQKHVLRPESLEGTDEEDPVTAVEWDPLSTDYLL
VANLHFGIRLLDSESLYCITTFNFPSAAASVQCLAWVPSAPGMFVTGDSQVGVLRIWNVS
RTTPIDNFKLKKTGFHCLHVLNSPPRKKFLAQSPTKNHYMSSTSEAVPQPTLTQNQAFSL
PPGHAVCCFLDGGVGLYDLGAKKWDFLRDLGHVETIFDCKFKPDDPNLLATASFDGTIKV
WDINTLTAVYTSPGNEGVIYSLSWAPGDLNCIAGATSRNGAFIWDVRKGKMVQRFNEHGK
NGIFCVAWSHKDSKRIATCSGDGFCIIRTIDGKVLHKYKHPAAVFGCDWSQNNKDMIATG
CEDKNVRVYYVATSSDQPLKVFSGHTAKVFHVKWSPLSEGILCSGSDDGSVRIWDYTQDA
CINILSGHTAPVRGLMWNTEIPYLLISGSWDYTIKVWDTREGTCLDTVYDHGADVYGLTC
HPSRPFTMASCSRDSTVRLWSLTPLITPLLINILADRSWEEIIGNTDHAIEQGSPPLLCG
KVSRDIKHEIEKLTGNPRAKKLRWFSECLSPPGGSDNLWNLVAVIRGQDDSLLPQNYCKG
IMHLKHLIKFRMSEAQELTTVKMSKFGGGIGVPTKEERLKEAADIHLRLGQIQRYCELMV
ELGEWDKALSVAPGVSVKYWKKLMQRRADQLIQEDKDEVIPYCIAIGDVKKLVDFFMSRG
QLKEALLVAQAACEGNMQTLHVSTPKGSSSSDDIYKEDFNELLHKVSEELAEWYFRDGRA
VLAACCQLAVDNTERAMAYLIRGNELELAVCVGTTLGEAAAPGTHYALELLARKCMMIPT
WNLAADLLLMTPDNELQLVKLCAFYPGCTEELNDLREKCKLPTVEECMQLAETAHADGNI
FETVKYYLLSQEPEKALPIGIDFIKEYITSSNWTLDTIYPVLDLLSYIRTEKLVLHTCTK
ARNELLILCGYIGALLAIRRQYQSIVPALYEYTSQLLKRRAVSVPLKIEHLSEELDAWRA
CTQSVSRSSEESAYTPPSDSQKMVYATLLKRLEQEPLRGIVGPDYVTGSNLPSHSDIHIS
CLTGLKIQGPVYFLEDGKSTISLNDALMWAKVNPFSPLGTGIRLNPF
Download sequence
Identical sequences M3YKU9
ENSMPUP00000011956 XP_012902805.1.14098 ENSMPUP00000011956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]