SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3YN91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YN91
Domain Number 1 Region: 417-515
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-21
Family SH2 domain 0.0007
Further Details:      
 
Weak hits

Sequence:  M3YN91
Domain Number - Region: 9-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00691
Family SAM (sterile alpha motif) domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YN91
Sequence length 536
Comment (tr|M3YN91|M3YN91_MUSPF) Lymphocyte cytosolic protein 2 {ECO:0000313|Ensembl:ENSMPUP00000012798} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=LCP2 OC=Mustelinae; Mustela.
Sequence
MALKNVPFRSDVLSWDPDSLADYFRKLNISSMESCLVPQFNTHHIRLLNNLTENDIQKFP
KLRVPILSKLSQEINKNEERRSIFTRKPQVQRFPEETESHEEDNGGWSSFEEDDYESPTD
DQNEDDNDDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSTYIADRP
PSSKAPQQPPVPPQRPMAGLPPPPAGRSHPPLPPPQPNHEEPSRSRNHKTAKLPAPSIDR
STKPPLDRSLAPFDREPFTLGKKPPFPDKPSAPAGRPLGEHLPKMQKPPLPPATERHDRG
TPLPGKKPPVPRHGWGQDRRENDEDDVHQRPLPQPTMPSMSSNTFPSRSTKPSPKHALPS
PHMPGAFSESNSGFPQSASLPPYFSQGLNHRPPPRAEGRNFSLPVPNKPRSLASGEEENS
LNEEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTITNPYVLMVLYKDKVYNIQIRYQ
EESQVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHSAGYP
Download sequence
Identical sequences M3YN91
ENSMPUP00000012798 ENSMPUP00000012798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]