SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3YNG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YNG5
Domain Number 1 Region: 71-166
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-24
Family SH2 domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 209-256
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000249
Family SOCS box-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YNG5
Sequence length 257
Comment (tr|M3YNG5|M3YNG5_MUSPF) Cytokine inducible SH2 containing protein {ECO:0000313|Ensembl:ENSMPUP00000012872} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CISH OC=Mustelinae; Mustela.
Sequence
MVLCVQGPCSLLAVERIGQRPLWAQSLELPEPAMQPLPAGAFLEEVAEETPAQPESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADPRSDSPDPAP
TPAPPTPKEDVPGDPALPVPTVTAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCL
PLPRRMANYLRQYPFQL
Download sequence
Identical sequences M3YNG5
ENSMPUP00000012872 XP_004760604.1.14098 ENSMPUP00000012872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]