SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3YR22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YR22
Domain Number 1 Region: 17-178
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.75e-35
Family Glyoxalase I (lactoylglutathione lyase) 0.0000000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YR22
Sequence length 184
Comment (tr|M3YR22|M3YR22_MUSPF) Glyoxalase I {ECO:0000256|RuleBase:RU361179} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=GLO1 OC=Mustelinae; Mustela.
Sequence
MAEPQPASSGLTDEAALGCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRILGMTLLQK
LDFPTMKFSLYFLAYEEKNDIPKDKDEKIAWVFSRKATLELTHNWGTEDDETQSYHSGNS
DPRGFGHIGIAVPDVHGACKRFEELGVKFVKRPDDGKMKGLAFIQDPDGYWIEILNPNKM
TTII
Download sequence
Identical sequences M3YR22
ENSMPUP00000013781 XP_004740049.1.14098 ENSMPUP00000013781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]