SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3YTG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YTG3
Domain Number 1 Region: 34-146
Classification Level Classification E-value
Superfamily FKBP-like 7.07e-36
Family FKBP immunophilin/proline isomerase 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YTG3
Sequence length 200
Comment (tr|M3YTG3|M3YTG3_MUSPF) Peptidylprolyl isomerase {ECO:0000256|PROSITE-ProRule:PRU00277} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=FKBP11 OC=Mustelinae; Mustela.
Sequence
MTLRPSLLPLRLLLLLLSGVMCRAEAGFETESPVRSLQVETLVEPPEPCAEPAAFGDTLH
IHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGK
RGFPPSIPADAVLQFDVELIALIRANYWQKLVKGILPLVGMAMVPALLGLIGYHLYKKAN
RPKVSKKKLKEEKRNKSKKK
Download sequence
Identical sequences M3YTG3
ENSMPUP00000014623 XP_004778960.1.14098 ENSMPUP00000014623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]