SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3YUM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YUM6
Domain Number 1 Region: 1031-1226
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000324
Further Details:      
 
Domain Number 2 Region: 819-952
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-25
Family Pleckstrin-homology domain (PH domain) 0.0000338
Further Details:      
 
Domain Number 3 Region: 7-38,69-140
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-20
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YUM6
Sequence length 1310
Comment (tr|M3YUM6|M3YUM6_MUSPF) Rho GTPase activating protein 23 {ECO:0000313|Ensembl:ENSMPUP00000015036} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ARHGAP23 OC=Mustelinae; Mustela.
Sequence
MLPLGPRDGCSPGRPLPWQGPRTLLLHKSLQDGFGFTLRHFIVYPPESAVHCSLKEEENG
GRGGGGGGPSPRHHRLEPMDTIFVKNVKDDGPAHRAGLRTGDRLVKVNGESVIGKTYSQV
IALIQNSDDTLELSIMPKDEDILQLAYSQDAYLKGNEPYSGEARSIPEPPPICYHRKTYA
PPARVSAWATMVPEPLSAPPSDPRSPAAWSDPGPRVPSTTRTHPDNPSLGMSQPRPSPGA
FPRDRLEDVTAHRPWPCSTSQGALSQLGQEGWHRARSDDYLSRATRSAEALGPGALVSPR
FERCGWASQRPSARTSACSSRDLPAPQAQPPPGLQGLDDIGYIGYRSYSPSFQRRTGLLH
ALSFRDSPFGGLPTFSLAQSQASFPPEASEPPRVVRPEPSTRALEPPTEDRRDEVILRQK
PPTGRKVQLPPARQMNLGFGEESPEPETSGRVERLGKKVAPLATTEDSLASIPFIGEPFF
CSFVLQPPFLPPSHSFFSPLLFSSLFLLPPVFPPLSPSLPFVCPPTHPFLSLLLSCSLSP
PSLCLFVHFSLPSLHPFFILPFLCSFHSSFLPSTLHPTNTSVRHRARLCALLECVVPRQG
QSRGDAEGVLPGEQMLDKGEARVERPADSQVSGLTRGLCLTSISGMKQGLGGLEHWGCGL
GLEVRLGMGWAGSALSHLYPPLPLLADEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTS
PSSPTFTFALGRHYSQDCSSIKAGRRSSYLLAITTERSKSCDDGLNTFREESRALSGHYL
PSVVSLQSLDSWGTSEDADAPSKRHSTSDLSDATFSDIRREGWLYYKQVLTKKGKKAGGG
LRQWKRVYAALRARSLSLSKERREPGPAAAGAAAAVAGEDEAAPVCIGSCLVDISYSETK
RRHVFRLTTADFCEYLFQAEDRDDMLGWIRAIRENSRAEGEDPGCANQALISKKLNDYRK
VSHSSGPKDDSSPKISRGLGGLKSEFLKQSTARGLRTQDQPAGSKDDSAAPPKTPWGINI
IKKNKKAAPRAFGVRLEECQPAIENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVS
SLQEQLNRGPGDINLQDERWQDLNVISSLLKSFFRKLPEPLFTDDKYNDFIEANRIEDSR
ERLKRLRKLIRDLPGHYYETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDN
MADMVTHMPDRYKIVETLIQHSDWFFSDDEDKGERTPVDDKEPQSVPNIEYLLPNIGRTV
PPGDPGSDSTTCSSAKSKGSWAPKKEPYAREMLAISFISAVNRKRKKRRE
Download sequence
Identical sequences M3YUM6
ENSMPUP00000015036 ENSMPUP00000015036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]