SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3YVY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YVY0
Domain Number 1 Region: 250-519
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.92e-80
Family Protein kinases, catalytic subunit 0.00000000122
Further Details:      
 
Domain Number 2 Region: 111-238
Classification Level Classification E-value
Superfamily SH2 domain 1.22e-38
Family SH2 domain 0.00000661
Further Details:      
 
Domain Number 3 Region: 72-115
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000019
Family SH3-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YVY0
Sequence length 526
Comment (tr|M3YVY0|M3YVY0_MUSPF) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=FGR OC=Mustelinae; Mustela.
Sequence
MGCVFCKKLEPGLKEDVGLESDFRGSGAADRYGPDPTQARTVSSFAHIPNYNFSTQSTSP
AFLDGSTIRGISGTGVTLFVALYDYEARTEDDLPFTKGEKFHILNNTEGDWWEARSLSSG
QTGYIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPRGAFLIRESETTKGGYSLS
IRDWDQARGDHVKHYKVRKLDTGGYYITTRAQFDSVQELVQHYIEVNDGLCHLLTVACTT
MKPQTIGLAKDAWEISRSSIALERRLGTGCFGDVWLGMWNGSTKVAVKTLKPGTMSPKAF
LAEAQIMKMLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLEFLKDREGQDLTLPQLVDMA
AQVAEGMAYMERMNYIHRDLRAANILVGERLVCKIADFGLARLIEDDEYNPQQGAKFPIK
WTAPEAALFGRFTIKSDVWSFGILLTELISKGRVPYPGMNNREVLEQVEHGYHMPCPPGC
PASLYEVMEQTWRLDPEERPTFEYLQSFLEDYFTSTEPQYQPGDQT
Download sequence
Identical sequences M3YVY0
ENSMPUP00000015490 XP_004741109.1.14098 XP_004741110.1.14098 XP_004741111.1.14098 XP_004741112.1.14098 XP_012902546.1.14098 XP_012902560.1.14098 XP_012902564.1.14098 XP_012902568.1.14098 ENSMPUP00000015490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]