SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3YX50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YX50
Domain Number 1 Region: 900-1084,1162-1354
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.35e-39
Family Quinoprotein alcohol dehydrogenase-like 0.021
Further Details:      
 
Domain Number 2 Region: 1268-1518
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.33e-31
Family WD40-repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 349-569
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000863
Family Extended AAA-ATPase domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YX50
Sequence length 1602
Comment (tr|M3YX50|M3YX50_MUSPF) NACHT and WD repeat domain containing 1 {ECO:0000313|Ensembl:ENSMPUP00000015910} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NWD1 OC=Mustelinae; Mustela.
Sequence
MCRARRPWRTKSLYSWDSCPCGKTSNKETRRNISAGDMDAEREALQSTAFPEVQTFCQKH
GLMFEVVDLRWGIRSSEATDHMTTELCLEELDRCRKTSIGPAFVALLGDQYGPCPVPTLI
EEKEWEALRTQLTSRPRDLELVARRFQRDENSVPPTYLLQALGATEARGPEEATLTSVLR
SGAQEAGRLGLITQEQWVRYHWSVIEWEIDRGLLSLTDGDQGATVFLREIQDLNKHILDD
CALKMVDRLADGCLDMDAQNLLGGLKGRIADTQPGVLKTHHLPWSRDLVNPKNKTHARYL
KELGEQFVARANHQVLEHLRELEASRQELAWLYQEIRHHMALSAEATRTFCGRQELLAQL
GKRLRQSDSQPHSPLVLFGPPGIGKTALMCKLAEQTSGLLDRKTVTVLRLLGMSQMSSDA
RGLLPSLCFQLCLAYGLPLPPAQVLEAHARVVQLFHTLLHTVSCRNFESLVILLDSMDDM
DSICRARRVPWLPSTCPPRVHLILSACSGQQGVLDTLRRTLTDAEAFWEVKPLSGNQGQE
MIQTLLAASRRTLSPEQRELVWASLPECGHPGRLRLAFEEARKWASFTVPAPLGSTAEEA
MHQLCARLEQTHGQLLVAHVLGYLASSRHGLSEAELKDVLSLDDEVLQAVYQDWTPPSKE
LLRFPPLMWVRLRRDLGHCLARRPVDGFTLLAIAHRQLAEVVQERYLSRPERAKRHGVLA
DFFSGAWSLGTKKLITLPLVGKPLNLDRKVAPQPLWFSDTVANLRKLKELPHHLVHSGRT
EELKQEVLGNMNWISCRGISGGIEGLLEDFDLYGPHLDCPEVSLVRDALQLCRPAVELRG
MERSILYTELLARLHFFAASHPALVGQLCQQAQSWFRACPHPVLIPLGGFFQPPGGPLRA
TLTGCHKGITAMAWSLEERLLVVGTQDGIVAVWDMEEQQVIHILTGHTGEVKYVKVFAKG
TLALSASKDHTLRLWDLLSGQEKFTIWDRGSRDPTEPEIWSLHVEEAKKVVYLASGSKIS
AWNLETAELVFRILGHVSDRWMCTRVLASRAMLLTVSEAGVVSLWSSATGTLQGRQHLSS
VKEETPTCGVSVQKQGKMVTGFSKGSISLVSPEGDSLLEKLPEAVRFLVLSEDESLLAAG
FGRSVRIFLADSQGFHRFMATDLEHEDMVETAGFGPKNNLIITGSRDALIQVWSLSEQGT
LLDILEGVGAPVSLLAWGGALVASASQQSSSFKVWDLTYLQKPRACTPFLDRTGLTAVSH
NGGYIYFPKIGDKNKVTIWDSAEGEEQDALDTSNEVRCLEVAQQANLLFTGLVSGVVLVF
PLNSRQDVMCIPPPEARKAINCMALSQGEERLAIAYDSIVLVLDLSPGDPCPVIDGPTYT
FYTQLPETISSVAVLADYRVIYGMTNGDLFLYECVNSKVFPLEAHGSRVTCMQVSHREQL
AVSGSEEALLCLWDLQACKWTFQMNYTNSYCRGVQCLCFSMDDKYVYAGLKDRSIIVWSV
LDGTLLAVQFVHAVVNRIIPTSNGFIAPTRHGYLIRERFQCPSSRTSQQDPLKNFKKAVW
KVKSRQREELAAAAGTLQDLRSASARGNECKSNKRSQVCLLV
Download sequence
Identical sequences M3YX50
ENSMPUP00000015910 ENSMPUP00000015910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]