SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3Z3G7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z3G7
Domain Number 1 Region: 525-556,638-712
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000129
Family Anti-sigma factor antagonist SpoIIaa 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Z3G7
Sequence length 760
Comment (tr|M3Z3G7|M3Z3G7_MUSPF) Solute carrier family 26 member 3 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SLC26A3 OC=Mustelinae; Mustela.
Sequence
MIEPIGNQYVVARPVYSANNLSISEHSEMRAEESSQLKCCKSQANCSTQKAKKIALSLFP
IASWLPTYQIKEWLLSDIVSGISTGLVAVLQGLAFALLVTVPPSYGLYAAFFPVLVYFFL
GTSKHISVGPFPVLSMMVGAVVVKLTPSESTAALEISNSSMSNDSSTDEYKVMVAATVTV
LSGIIQLLMGVLRVGFLVIYLSESLISGFTTAAAVHVLVSQLKFMLQLTVPAHTDPFSIF
KVLNSVFTQIEKTNIADLVTSLIILVIVFVVKEINQRYKAKLPVPIPIELIMTVIATGVS
YGFDFENRFKVAVVGEMKRGFQPPIAPDTQIFQETIGDSFGIAIVGFVVAFSVASVYSLK
YDYPIDGNQELIALGLSNIFSGSFQGFAGSTALSRSGVQESTGGKTQIAGILSAIIVLIV
ILALGFLLEPLQKSVLAALALGNLKGMLMQFTEIRRLWRKDKYDCLIWIMTFIFAIVLGL
GLGLAASVAFQLLTIVFRTQFPKCSTLANVGRSNIYKNKKDYSDMYEPEGVKIFRCPAPI
YFANIHFFKQKLIDAVGFNPLRILRKRNKALKKIRKLQKKGLLQVTPKGFICTNDGFKDS
DDELDNNEIEELDQPIHTSDLPFQIDWNADLPLNMVVPQISLHSLILDFSAVSFLDISSM
RGLKTILQEFIRINVDVYIVGSDDDFIEKLVQCEFFDDEVKDSIFFLTIHDAVLHIWMTK
DYNASKFNASQEKEMKFDFTINTNGGLRNRECQVPVETKF
Download sequence
Identical sequences M3Z3G7
ENSMPUP00000018129 ENSMPUP00000018129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]