SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3Z3J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z3J1
Domain Number 1 Region: 491-523,598-672
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000589
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Z3J1
Sequence length 704
Comment (tr|M3Z3J1|M3Z3J1_MUSPF) Solute carrier family 26 member 5 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SLC26A5 OC=Mustelinae; Mustela.
Sequence
MDHAEENEILAASQRYYVERPIFSHPVLQERLHKKDKISDSIGDKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGPFAVISLMIGGVAVRLVPDDIV
IPGGVNATNGTEARDALRVKVAMSVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAA
AVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKE
FNERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFH
LVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSL
SRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFAD
LPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDT
DVYIDIDAYEEVKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNPAVIMGARRKAMKK
YAKEVGNANVANATVVKVDAEVDGEDATKPEEENDEVKYPPIVIKNTFPEELQRFMPPGE
NIHTVILDFTQVNFIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVINDLTQNRFFENPA
LKELLFHSIHDAVLGSQLREALAEQEASVLPPQEDSEPNATAEA
Download sequence
Identical sequences M3Z3J1
ENSMPUP00000018153 ENSMPUP00000018153 XP_004739638.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]