SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3Z7E3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z7E3
Domain Number 1 Region: 277-385
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-25
Family SH2 domain 0.000000557
Further Details:      
 
Domain Number 2 Region: 389-429
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000327
Family SOCS box-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Z7E3
Sequence length 441
Comment (tr|M3Z7E3|M3Z7E3_MUSPF) Suppressor of cytokine signaling 4 {ECO:0000313|Ensembl:ENSMPUP00000019506} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SOCS4 OC=Mustelinae; Mustela.
Sequence
MAENSESISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKNESCSDAETVNAVEKTEV
PLRSQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSGRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSSEWVSTDSSQSELRDGQLKQRR
NVEEEVNCFSQTNVQPCVITTNSASSCRGGPMTGSVMNLLSNNSIEDSDMDSDDEIITLC
TSSRKRNKPKWEMDEEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEA
LLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDIT
GLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLY
LKEYHYKSKVRVLRIDAPEQC
Download sequence
Identical sequences M3Z7E3
ENSMPUP00000019506 XP_004738877.1.14098 ENSMPUP00000019506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]