SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z9X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z9X6
Domain Number 1 Region: 197-262
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-17
Family Second domain of FERM 0.0000237
Further Details:      
 
Domain Number 2 Region: 81-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000285
Family First domain of FERM 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Z9X6
Sequence length 263
Comment (tr|M3Z9X6|M3Z9X6_NOMLE) Uncharacterized protein {ECO:0000313|Ensembl:ENSNLEP00000023513} KW=Complete proteome; Reference proteome OX=61853 OS=leucogenys). GN= OC=Catarrhini; Hylobatidae; Nomascus.
Sequence
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLE
Download sequence
Identical sequences M3Z9X6
ENSSSCP00000020362 ENSSSCP00000020362 XP_020752470.1.74333 XP_020752471.1.74333 XP_020752472.1.74333 XP_020752473.1.74333 XP_020752474.1.74333 XP_020752475.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]