SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3ZJW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZJW3
Domain Number 1 Region: 252-381,412-482
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.02e-37
Family Hemopexin-like domain 0.00085
Further Details:      
 
Domain Number 2 Region: 62-103
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000085
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 22-61
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000183
Family Somatomedin B domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3ZJW3
Sequence length 485
Comment (tr|M3ZJW3|M3ZJW3_XIPMA) Proteoglycan 4b {ECO:0000313|Ensembl:ENSXMAP00000002505} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MSSKKFMVATLLVGALKFISSQTSCRERCGAEYYRGNTCQCDYTCLSYDECCNDYEAQCT
EKNSCKGRCGETFKRGRQCNCDPECSKFNQCCPDYKKHCDENVCFSIEIPDSSTPYPPTD
VGDGDGEQKHHEEFSKQRFPDITITDSVNLSLVDIFAEIFPGDDLSTNGDVQLEASPSPE
VSSGDGPTPVEPSDEIPTEPTLVRDDPQFSTEPTPVDDILTSAAITTASTGRGKSFPNNV
LICPPDDSDDTNLCSGRPVSGITTLRNGTMVVFRGHYFWVLDRNLVPSSPKGITAVWGVP
SPIDTVFTRCNCQGKTYIFKGGKYWRFENDALDPGFPKVVKTGFDGLQGHITAALSVPQY
LSRKESVYFFKRGETVQKYSYQFGTSPKCGRTAHVPVYTVRARLVRQAGTEPPINIRKSW
KGFPSTITAAVSVPTNRNPEGYKYIVFSRSTAYNVRMHDGRPVVAAPRANVSSKTDNFFR
CPKKS
Download sequence
Identical sequences M3ZJW3
ENSXMAP00000002505 ENSXMAP00000002505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]