SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M3ZTF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3ZTF5
Domain Number 1 Region: 717-865
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.11e-38
Family Regulator of G-protein signaling, RGS 0.000075
Further Details:      
 
Domain Number 2 Region: 1054-1143
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.51e-28
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 238-359
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-20
Family Phosphotyrosine-binding domain (PTB) 0.0099
Further Details:      
 
Domain Number 4 Region: 4-79
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-19
Family PDZ domain 0.009
Further Details:      
 
Domain Number 5 Region: 1000-1068
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000815
Family Ras-binding domain, RBD 0.058
Further Details:      
 
Weak hits

Sequence:  M3ZTF5
Domain Number - Region: 494-502
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0126
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3ZTF5
Sequence length 1432
Comment (tr|M3ZTF5|M3ZTF5_XIPMA) Regulator of G protein signaling 12b {ECO:0000313|Ensembl:ENSXMAP00000005498} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
RIQAVEVARGRTGYGFTLTGQSPCVLSCILKGSPADYVGLRSGDCILSVNDINVSKASHE
DVVKLIGRCSGILKLIIAEAAAYLDSCSSDDELDVFYNNGCGTKGGWYKPKLDSKQLGIN
RAEKVVAELQSGGIFNMIFENSSHSSSSSDKDRPGVSSSSKPRQMSDPEFNPYHNASCTQ
SNPNLLSEEEMAQVLNDDSVFLESDFRHLHIHHHEEQDMDVGEGADFGLEPSEGILNVGM
IVGYLGSIELASTGTNLENDSLQAIRGSMRRLRAEQKIHSLVLMKVMHDSVLLCSDRGQV
LATYPAEKLAFSACCPDDRRFFGLVTMQATDDHDDRHFSNGRDDEGNLRTSCHVFIVDPE
LCHHQVHLGVARRFGFECTPDPDTGGCLEFPPSSQPLLQFVSVLYRDMGDNIEGVRARAF
HDPDNDAQQNHSTSSNSDSGIGNFLPEEKSNRVLLVDLGGPPSHNHMSGARQWDSPPSSQ
QAWSPILGAAASHPPPPPPPPPMLRNGHYLHDPHLADLPHPSPPWLTLTCQADSHKDSMR
GGGVGVEPQRWLPVHVLRDWRQQHQHHHSHFQGLSSDQESYAESTDGWSSANCSTLPPPM
NKIPADRYRAPLAPGDRMHPPGKDEWAKKLFGAGDRERNGARRAEREKKREKGGRFRGLT
MGFPPLPQRSSARRSFGRSKRLSMARSLDNLESAAVSDGELNSVELQGCSSDNSLNSNAS
LPSVQSHRRHTERRVASWAVCFERLLQDPVGVRYFSEFLKKEFSEENILFWQACEFFSHV
PENDNKQLSQRAREIYNSFLSSKATTPVNIDSQAQLADDILNAPKPDMFKEQQLQIFNLM
KFDSYTRFLKSRLYQECMLAEVEGRPLPDPYHIPSSPTSKHSTTGSDRSNLSTPKKEDKK
TKSGRSLNEDSRDDSGDRRKGMFFSWSRNRSFGKGPKKRELADHVFAHDASHQFSLLVCL
FSGTNGRRESQGSLSSEGTLDDISRGAVSERGGSSAPLRQCNISLPDGSCCPVPLRPGMS
IRDLLQGLCDKLCINLAAIDLFLVGGEKPLVLDQDCMTLSSRDLRLEKRTLFRLDLVPIN
RSVGLKAKPTKPVTEVLRPVVAKYGLHLSDLVARISGESEPLDLGLPISNLDGLRVVLDI
EENAMGKVLFLHTDKIKAAQSHLPASASRNQSATGDDRPTRKGGSAHPHGENGKAGPGAG
TSTQPLPNHSVSLHKAPGKRKQKKINIDEAEEFFDLISKAQSNRADDQRGLLNKSDLQLP
DFLRLTPTSPTTPPPRNPEPNCSTPNSRNTNNGGFPSSSQRGNKGNGNHRGGVVSGSYLL
SASHQSQSLDSALGAECGGGRKTRPPPPFPATVSPIQSTRPGAQGLLQDSARGESIQMLE
EDTLSDLTLVGEGDINSPSLNYITPSSLSSKPLPRPQHQAQDGQPCSGTSPV
Download sequence
Identical sequences M3ZTF5
ENSXMAP00000005498 ENSXMAP00000005498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]