SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M4AN55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4AN55
Domain Number 1 Region: 663-787
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.9e-38
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 2 Region: 979-1077
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-29
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 18-99
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.0057
Further Details:      
 
Domain Number 4 Region: 200-315
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000768
Family Phosphotyrosine-binding domain (PTB) 0.049
Further Details:      
 
Domain Number 5 Region: 925-993
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000107
Family UBX domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4AN55
Sequence length 1277
Comment (tr|M4AN55|M4AN55_XIPMA) Regulator of G protein signaling 12a {ECO:0000313|Ensembl:ENSXMAP00000015900} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
IQGQPEGARRRLDMNATGELRDVEVIRGRAGYGFTITGQKPCLLSGIMEGSPAFVVGLRQ
GDRIMAINGADVSAAAHETVVQLIGGCKGPLHMVVLSERRIMGNPILNDAKFGFEQKNSV
FQKPGVLRAVSHDSSRPSFNPNNGLAAKQRPVSEPDMSLWSQQFNVLSGKTKEEAPTVKD
TDYVFTDTEEVNPDWSVLNMTLVVGYLSSTELILNTSASEDDCLKAIRERIRQLGTEQDT
HTLVMMKVMFDCIRLCDEAGAVLAAFPAENLVLGAVCAEDPRFFCLVTTAHIINGRVPDD
GPLRASCHVFFIDPELGNHKDHIGIACRFGFNCTPDPDSMGCLEFPQTPPDVLHFVTVLY
SDLGEAVERLRAKLDMEAQQTDSTSKLGSASSNGDSGIENSSPPEERADRDFPSDIPNLS
GTHLPSCPWDYPSTEVVTPINPIKNGHKLEPENSASLHSLSESLPGPDSLTSFYGGPPPR
LEFHFKPPPPPLPLSKKTNFLAYPLRSSQRWFSKPKWPKALSSDSVNQETSTNINSTTNN
PPSALNQVHSDRYHSMMPPREEWTKRFLEQRQKQRAHGNYRNKKKYYSKGSRLWGIGVAR
ASKRRSSKRLSMARSLDDLESAASSDGDYSGIQLQGCCSHSSLTSNGSLPGAGGHRGSTD
QRVAGWSTCFERLLQDPVGVRYFSEFLKKEFSEENILFWQACEYFSHVPATDKKQLSQRA
GEIYNSFLSSKATMPVNIDSQAQLADDVLTSPQPEMFKTQQLQIFNLMKFDSYSRFLKSS
LYLECLHAEENGQPLPDPYQIPCSPAPSKHSASSDRSTLSTPKKTQDIRKQRSGKSLNED
TKDESADKKRGIFFSWSRNRSFGKGPKKKDIGDINLDFWGSNGRRESQGSLSSSASLEIP
NSVSAAKMESDNRHSVGAWERSSRHCSVLLPDGSCSSITLRPGASIREVLQDLCRNICVN
IAAVDLFLVGGEKPLVLDQDCMTLCSRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTE
VLRPVVAKYGLNLSDLVAKISGETEPLDLGAPISSLDGLRVVLERADPCSGKEKSKSSSL
KGHPPPRSFSAAGDERAAGPASALPEEKRKQKKINIDEAEEFFELLSRAQSTRANDQRGL
LKKEDLVLPDFLRLTPPTSSCSASSDLACSTPASLKPSRENGVPPRGSLTAALRSESLDS
SLSSSANGHSASRRCLLPPPRHSTFGTHLSPIPRPPDSRPSLRTVEEDAHADLTLVGEGD
ISSPNSTLLPPSPPSFP
Download sequence
Identical sequences M4AN55
ENSXMAP00000015900 ENSXMAP00000015900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]