SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M4AP59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4AP59
Domain Number 1 Region: 7-274
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-53
Family YWTD domain 0.00000312
Further Details:      
 
Domain Number 2 Region: 626-871
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-51
Family YWTD domain 0.00000676
Further Details:      
 
Domain Number 3 Region: 325-565
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-51
Family YWTD domain 0.00000215
Further Details:      
 
Domain Number 4 Region: 934-1187
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-38
Family YWTD domain 0.0000751
Further Details:      
 
Domain Number 5 Region: 1320-1357
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 1242-1280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 890-937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000136
Family EGF-type module 0.023
Further Details:      
 
Domain Number 8 Region: 1282-1318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 9 Region: 279-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000568
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 10 Region: 582-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000168
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 11 Region: 1200-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M4AP59
Sequence length 1623
Comment (tr|M4AP59|M4AP59_XIPMA) Uncharacterized protein {ECO:0000313|Ensembl:ENSXMAP00000016254} KW=Complete proteome; Reference proteome OX=8083 OS=Xiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus). GN= OC=Poeciliinae; Xiphophorus.
Sequence
MAVDGSPLLLFANRRDVRLVDGDGVRGESAIVVSELEDAAAVDFLFDESLIFWTDVSEEA
IKQTHWNQSFNSLKEALGTGQAVVVSGLNSPDGLACDWLGKKLYWTDSETNRIEVANLDG
TSRKVLVWMDLDQPRAIALNPGQRYMYWTDWGEEPRIERAGMDGSSRKVIVNKNIHWPNG
LTIDLVEEKLYWADAKLSFIHRANLDGSVREAVVEGTLTHPFALTLSKETLYWTDWQTRS
IHACNKHSGDKTREILGGIYSPMDIQVLEPYRQPYIQTPCSNDNGGCSHLCLLSPLQPFY
SCACPTGVQLKADGKTCKPGAEQVLLLARRTDLRRISLDLPDFTDIVLQVHDIRHAIAID
YDPVEGFVYWTDDEVRAIRRSYIDGSNAMILVTMDINHPDGIAVDWVARNLYWTDTGTDR
IEVTRLNGTSRKILISEDLEEPRAIVVDPVNGFMYWTDWGQHPKIERANLDGTARVVLLN
SSLGWPNGLAIDYTAGKLYWGDAKTDKIEVINVDGSNRQTLLEDKLPHIFGFSLLGEYIY
WTDWQSRSIERIHKATAVREIIIDQLPDLMGLKATKVTETHGTNDCVENNGGCSHLCFWC
EQAVRCACPMGLELLSDLRTCVVPEAFLLFTNRDSIRSISLGTNSNDVAIPLTGVKEASA
LDFDVSERRIYWTDIQAKTISRAYMNGSSVEHVLEFGLDYPEGMAIDWMGRNIYWADTGT
NRIEVARLDGQYRQVLVCKDLDNPRLLDNPRSLALDPANGYMYWTEWGGRPRIARAYMDG
STISTLVDKVGRANGLTIDYVEHRLYWTDLDTCMIECTNMQGLQREIIVDDLPHPFGLTQ
YRDFIYWTDFNLRSIERADKRSGLNRTVVLQGQLELMLDILVHSSRQDGTNECSQNNGNC
GHLCLATPAGAQCRCAFHYTLNPDGKNCSSPSSFLLFSQRASISRMVLGDQSPDIILPIH
VTRNVRAVSYDPLERLVYWLDGRQNIRRARDDGTMSSIIVSSPAQQVDNQLHDLSLDPYS
RHIYWTCETTNTITVQKMDGRIVGVVVKDDTDKPRAIVVNAEKGYMYFTTVQEHSAKIEG
ASLDGTERESLFSTGLIRPVALALDNKLGKLFWVDADLKRIESSDLTGANRIVLQDSNIL
QPMGLTVLGDHLYWIDRQQQMIERVDKLTGEFRTRIQGRISYLTSIHAAWEMDPSEFASH
PCSRDNGGCSHICIAKGDGTSTCSCPMHLVLLQDLLHCGEPPTCSTEQFTCSTGEIGCIP
MAWRCDGFPECDDGSDEMHCPICSAFQYQCDEGNCIDAQKRCDGEPDCPDKSDEHECDTV
CPPNQFRCGDNHCITKKQQCDNYSDCLDGSDELACDYISPSSSFIPSNETTNPIGPVIAI
ILLMFVMGGACFVCQRVVCRRYKGPNGSFPHEYISGTPHVPLNFISPSSSQHGTYQGISC
GKSTLSSVSLMGSSSSGAPLYDRNHVTGASSSSSSSTKGAFYPKILNPPPSPATDRSLYN
TEIFYSSNSPSTTRSYRPYHPVHGGAPPTTPCSTDVCDSDYTPHHPPAGMPLSGGRWKAP
GHAAHGKPTKYYMDLNSDSDPYPPPPTPRSQYMSAEESCPPPSTERSYFHLCPPPPSPCT
DSS
Download sequence
Identical sequences M4AP59
ENSXMAP00000016254 ENSXMAP00000016254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]