SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M4E5D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4E5D5
Domain Number 1 Region: 188-557
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.7e-64
Family L-arabinose binding protein-like 0.0013
Further Details:      
 
Domain Number 2 Region: 553-683,764-878
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.5e-37
Family Phosphate binding protein-like 0.0094
Further Details:      
 
Domain Number 3 Region: 3-71
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000746
Family B3 DNA binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4E5D5
Sequence length 985
Comment (tr|M4E5D5|M4E5D5_BRARP) Glutamate receptor {ECO:0000256|PIRNR:PIRNR037090} KW=Complete proteome; Reference proteome OX=51351 OS=pekinensis). GN= OC=Brassica.
Sequence
MNINGIKKQNEIILMDKHGVKCVTKLVKDGSKYGKRGLGKGCKDFCEANDVLKIGQPFMS
ELVWEDSVPVLTILRKQVHSIRFDTLNNNIIYDFSNHLCNKRALPYRPPRCFLSLQVLTM
TREHYLALNLLFLVIVLLMQVGEGQQNRASDVKVGIVDDVGMAYSNMTLFCINTSLSDFY
SSHPETWTRLVTTVVDSKKDVVIAAASALDLITNNEVKAILGPWNSMQAQFMIEIGQKSQ
VPIVSYSATSPFLASIRSQYFFRATYDDSSQVHAVKAIIKLFGWREVVPVYVDNTFGEGI
MPHLTDALQEINVRIPYRTVISPNATGDEISVELLRMMTRPTRVFVVHTEDLLASRFFAK
AKEIGLMKQGYVWILTNGITDGLSLMKEAETDAMQGVLGVKTYVPRSDKLEAFKSKWKNR
FPLSDLSVYGLWAYDATTALAMAIEEAGASNLIFAKTDDAMRNMSGLQGLGVSQYGPKLL
QTLSKVRFKGLSGDFRFINRELQPSVLEIVNVNGHGGRTIGYWTKEHGLLKYVDQRQATT
TTFTTWKDRLRPIIWPGDTTFVPKGWEIPTNGKRLKIGVPTNNHFPQFVKGTKDPITNST
IFSGFCIDYFEAVIQAMPYDVSYDFFPVEDMDYETMVHQVYLGKYDAVVGDTTISANRSM
YVEFSLPYTPLLSFFIIAVVVWVLEHRVNPDFDGPGRYHYTLVLFLHHGERVLSFWARLV
VIIWYFLVLLLTQSYTASLASLLTSQQLYPTVTNINSLLAKGERVGNQRSPFILGRLRES
GFSDANLVTYGSPEQCHELLDTEPAKGGVSAVFMELPYVRLFLGQHCNKYKMVQTPFKVD
GFGLVFPIGSLLVADVSRAILKVEESNKANQLESAWFKKIDESCPDPLTSPDPNPSESFR
KLGIDSFWVLFVAAAIVCVTALGKCMFHFLKENPDQRNLQGLWESPPERHAVIDLVAASH
RRQDPCKHRVCFMLELGLHSRSAMY
Download sequence
Identical sequences M4E5D5
Bra023989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]