SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M4ZUQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M4ZUQ4
Domain Number 1 Region: 6-170
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000273
Family Thioltransferase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M4ZUQ4
Sequence length 217
Comment (tr|M4ZUQ4|M4ZUQ4_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:BAN00423.1} KW=Complete proteome; Reference proteome OX=1313172 OS=Ilumatobacter coccineus YM16-304. GN=YM304_01090 OC=Acidimicrobiaceae; Ilumatobacter.
Sequence
MSDTTTEIEFWIDPACPFCWATARWVVDEVVPHRDISVTWRSISLLFKNDPPEGSEYRTA
AEQTHGHLRVMEAMRAAAESPEQGNHDVFKLYWELGARLHHDGNRDFEVAEALEAVGLDT
SFASAATDEQWDPAIQAAMDDGLGLVGNDVGTPIIAMKNSRGERVGYFGPVITKVPTGDD
SLKMWDALVAMMDVDGFFELKKTRTEGPNPGARPDPV
Download sequence
Identical sequences M4ZUQ4
gi|470176317|ref|YP_007562361.1| WP_015439671.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]