SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M5A001 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5A001
Domain Number 1 Region: 1-58
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 2.32e-19
Family Ribosomal protein L32p 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M5A001
Sequence length 60
Comment (tr|M5A001|M5A001_9ACTN) 50S ribosomal protein L32 {ECO:0000256|HAMAP-Rule:MF_00340} KW=Complete proteome; Reference proteome OX=1313172 OS=Ilumatobacter coccineus YM16-304. GN=YM304_18640 OC=Acidimicrobiaceae; Ilumatobacter.
Sequence
MAVPKKKTSKSKTRSRRASAWKLNAPARSICPRCSSAKVPHTVCSSCGWYRDRYVVDVKS
Download sequence
Identical sequences M5A001
gi|470178072|ref|YP_007564116.1| WP_015441425.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]