SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M5A0L8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5A0L8
Domain Number 1 Region: 1-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.73e-43
Family Glutathione peroxidase-like 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M5A0L8
Sequence length 164
Comment (tr|M5A0L8|M5A0L8_9ACTN) Thioredoxin peroxidase {ECO:0000256|HAMAP-Rule:MF_00269} KW=Complete proteome; Reference proteome OX=1313172 OS=Ilumatobacter coccineus YM16-304. GN=YM304_16220 OC=Acidimicrobiaceae; Ilumatobacter.
Sequence
MAEVTLGGNPVHTSGELPEVGSSAPAFTLTGSDLGDVSASDFEGKNLVLNIFPSVDTPTC
ATSVRTFNERAASLDNTEVLCVSADLPFAQGRFCGAEGIDNVKTASTFRSSFGADYGIDL
TDGPLAGVLSRAVVVVGPDGTVKHTELVGEIAQEPDYDAALGAI
Download sequence
Identical sequences M5A0L8
gi|470177830|ref|YP_007563874.1| WP_015441183.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]