SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M5AGV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5AGV8
Domain Number 1 Region: 19-253
Classification Level Classification E-value
Superfamily Nqo1 FMN-binding domain-like 1.01e-79
Family Nqo1 FMN-binding domain-like 0.00000042
Further Details:      
 
Domain Number 2 Region: 341-456
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 1.22e-22
Family Nqo1C-terminal domain-like 0.00087
Further Details:      
 
Domain Number 3 Region: 254-340
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 0.0000000000000602
Family Nqo1 middle domain-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M5AGV8
Sequence length 468
Comment (tr|M5AGV8|M5AGV8_9ACTN) NADH-quinone oxidoreductase subunit F {ECO:0000313|EMBL:BAN00725.1} KW=Complete proteome; Reference proteome OX=1313172 OS=Ilumatobacter coccineus YM16-304. GN=YM304_04110 OC=Acidimicrobiaceae; Ilumatobacter.
Sequence
MSTAITRDYTPGFYEGDRPKIVTSRFEYEDSYTLERYLATGGYEGLKAALAKTPDEMSGE
VKASTLLGRGGAGFPAGVKWGFTPQGVWPRYLVVNGDESEPGTYKDRLLMERDPHQLIEG
CLIACYAAGLSQCFLYVRGEMALAHERIAAALNDAYDAGYIGKNILGSDFSVDIILHWGA
GAYVVGEETALIESLEGERGMPRLKPPYFPAAVGLYGQPTIVNNVETLANLPFIAANGSA
AYTAIGTETSPGTRMIAISGHVKRPGVYEIINGSTTFRDIIYGDEFCQGIRDDNELKAFV
PGGGSAPWFLPDQLDIPFEGREAGQAGSMLGSGAVMVMDETTDIPEAALTLTRFYAHESC
GKCVPCREGGTWLLRMLERVCSGHGTTADLDQMFQVGESICPGDMPHAASERLGLEATPF
PYKMTTICFVGPSAYAPLHSALTLFRDEFDAKVTESPKRISIPVTAAS
Download sequence
Identical sequences M5AGV8
WP_015439973.1.75388 gi|470176619|ref|YP_007562663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]