SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M5AKX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5AKX7
Domain Number 1 Region: 10-204
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 6.28e-31
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0069
Further Details:      
 
Domain Number 2 Region: 229-357
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 0.00000457
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M5AKX7
Sequence length 383
Comment (tr|M5AKX7|M5AKX7_9ACTN) Pigment production hydroxylase {ECO:0000313|EMBL:BAN02005.1} KW=Complete proteome; Reference proteome OX=1313172 OS=Ilumatobacter coccineus YM16-304. GN=YM304_16910 OC=Acidimicrobiaceae; Ilumatobacter.
Sequence
MMTHDDCIRAARNLAPLLSEKARDGEIARRPLDDVIEAARDSGLFSMMVPKRYGGHELDV
DTFFEVVLILSEADAAMGWLIGFYIEHAFWLAEYPEAVQDEAYGDADHVLAPAALNIAGG
TATPTDGGYLVNGRWSWGTGIVHATWVIAGCIAMDADGGATPMMFLLPRDEVDTIDTWHI
SGMCSTGSLDFTIDDVFVPEDRAVPFLGLLDGSWGIAARNDAPLYSTPLVPILALAAGLP
CLGAARGARAAFGEQVKEKIGATGMVKGEGNFGLIAEASLSIDAAELLMRDSLAKLLAHR
HDAGVDERSAWVSQIAHAVFMCRTATNTIASLVGASGAMLDNPIQRFARDINTASNHVVF
ERESRYGDHARQLFGQPITNQLV
Download sequence
Identical sequences M5AKX7
gi|470177899|ref|YP_007563943.1| WP_015441252.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]