SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M5BA06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M5BA06
Domain Number 1 Region: 296-590
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.58e-93
Family beta-glycanases 0.000000000525
Further Details:      
 
Domain Number 2 Region: 735-1020
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.11e-74
Family beta-Galactosidase, domain 5 0.000000109
Further Details:      
 
Domain Number 3 Region: 8-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-59
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.000000359
Further Details:      
 
Domain Number 4 Region: 588-707
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 5.61e-21
Family beta-Galactosidase/glucuronidase domain 0.00059
Further Details:      
 
Domain Number 5 Region: 206-295
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000000000791
Family beta-Galactosidase/glucuronidase domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M5BA06
Sequence length 1022
Comment (tr|M5BA06|M5BA06_9MICO) Beta-galactosidase {ECO:0000256|SAAS:SAAS00046613} KW=Complete proteome OX=1097677 OS=Clavibacter nebraskensis NCPPB 2581. GN=CMN_02074 OC=Clavibacter.
Sequence
MTHALPYFEDFAPTTGPARRPRSCLHSDAPRIVLNGDWRFRLSPTPRGLSDEMADPAFDD
SGWDEIPVPSHWVLGQDGRFGLPAYTNVQYPFPVEPPYVPDENPTGDYRVEIDVPTDWQS
LERVVLRFEGVESAFKVWLNGDEVGTAMGSRLSHEFDVTASLRPGSNVLAVRVHQWSIAS
YLEDQDQWWMPGIFRDVTLLGRPQGGIDDAWTRAEYDHETGAGTVHVEVDAEPAAFPVTL
EVEDLGIHVTWATPEDVAPVHVDRVEPWSAESPTQYQGFLRTNVEALSIRLGFRTVRIEG
DRFLVNGRRVVFHGVNRHEAHPERGRVFDEEHARADMMLMKQHNVNAIRTSHYPPHPRVL
DLADELGFWVIDECDLETHGFEFGGWVGNPSDDPRFADHYLDRIERTVERDKNHPSIVMW
SLGNESGTGRNLAAMSAWVHRRDPGRPVHYEGDYTGEYTDVYSRMYSNLQETESIGSDVI
PGDLLGCTPGEGMRQRTKPFILCEYVHAMGNGPGQIGEYEDLVLRYPRLHGGFVWEWRDH
GILTETADGEASYAYGGDFGEVLHDGNFVMDGMVLPDDTPTPGLAEYKAVVQPIAFGLER
DGGSASLVVENRYHSVSTALTSLVWVLAVDGDDIATGVLDAEPVVAGATARIPMPADALD
AGELAAARERGPAPEVWLTVQAILRDDEPWAEAGHVVAVQQFDLTPAPRPAVPARWLDAD
EETYPDAGATRLALGDGEFDLATGRLVRLGGLEVDGPRLELWRAPTDNDRSDSSGSYELA
DPRLTFGKGVPGPSSEARWRDAGLDRLTHRVRSVKVGSGSLTVVVRTSAAQSFDSVDTTY
CWTEGVDGDLDLRVDIVPSAGWAITWPRVGIRIDLPASVTNAEWFGTGPFESYPDSRRAA
LVGRFSSLVDDLGAVYSTPQETGHRSDLRELELGTFDGEHGIVIAARPDTAGRRPGFTAS
RHTPQELDRAAHPHELPASEAVHLYIDAAQHGLGSRACGLDVLPEHQLWPSARTLELTIR
SR
Download sequence
Identical sequences M5BA06
WP_015490743.1.38469 gi|473834043|ref|YP_007686341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]