SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M7Z4P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M7Z4P0
Domain Number 1 Region: 395-488
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000863
Family B3 DNA binding domain 0.04
Further Details:      
 
Weak hits

Sequence:  M7Z4P0
Domain Number - Region: 301-336
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0275
Family B3 DNA binding domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M7Z4P0
Sequence length 517
Comment (tr|M7Z4P0|M7Z4P0_TRIUA) Uncharacterized protein {ECO:0000313|EMBL:EMS54486.1, ECO:0000313|EnsemblPlants:TRIUR3_12529-P1} KW=Complete proteome; Reference proteome OX=4572 OS=Triticum urartu (Red wild einkorn) (Crithodium urartu). GN=TRIUR3_12529 OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
MGPSTCTAVGSFGKEDIVISSGEEDQTPPPQEQRPPQQLRLLSEATLTVGEFTCQTEIMT
EPPSLLRYHGKWEPASPLQQKNSSILPRSNPTTVSTRDNTFKKGSRVQKKRFPQSGSFNI
GFNAHTSWKIHTASKVVDGCNDHLMEKVLVRKKNVPSGGGLQLGTKKITYTSADKLERIG
FVKVLQKRMKGWGARDEGGRGLEPCDSPGCVHTGLITPPATLRGANSCAYGPVCNPHVPA
PDSENLIVVPGWKNRQVLGAYIEHVQSVVARENKPVGAPIFVTREQLEYEVMIDHGAIRT
RIHGPGWQRFLDEYAVRPGDMVYICLTRGDGRFFVEVEMGGIRQTPLPYIALNGLSLVHR
ELVDQCVYTRGIRLEFPEMRKMIRRAFTPLEDICCIFVHKMTGVDIRGGYMRLPKKAVDL
IESKTGHMDNSGSILLHDDTGALVAASFKKANDGRLVIQGGFPKCVGQLELKENDLVVIT
FHRRGMDYLYIDIDAMLNLGAAHICLLFCVLRHGSDL
Download sequence
Identical sequences M7Z4P0
TRIUR3_12529-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]