SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8AVK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8AVK3
Domain Number 1 Region: 197-271
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000353
Family B3 DNA binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M8AVK3
Sequence length 291
Comment (tr|M8AVK3|M8AVK3_AEGTA) B3 domain-containing protein {ECO:0000313|EMBL:EMT08502.1, ECO:0000313|EnsemblPlants:EMT08502} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_21144 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MHMVLPPEEEDAHTNTSAVGTPQNKASEEEEAEEEEDALSESLENEEDSESRMCCDDALE
PTQQQQDYRHKTDDEESEHRPTKKSKFEEIRSPFGDSASKAASLGDNFVEFASRPSKESQ
AEGKSSAAPLIVYTRHKSFGNKYGMEAQFTMFNKSNGENQPGRVLIRVTRRLGLTSQRRP
VTQREKEDAMERARRSNRFMKTFLPKESRTMTLWDPQAKPWKAWYKYTCGECPHAVLSAG
WGTLAMENNLEKWDMCVFELLDQEYNIKLHIHKVFLMITPCVLAPKPRIDE
Download sequence
Identical sequences M8AVK3
EMT08502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]