SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8AZ83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8AZ83
Domain Number 1 Region: 311-402
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.87e-20
Family B3 DNA binding domain 0.0039
Further Details:      
 
Domain Number 2 Region: 95-194
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.9e-19
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 3 Region: 534-641
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.81e-17
Family B3 DNA binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M8AZ83
Sequence length 644
Comment (tr|M8AZ83|M8AZ83_AEGTA) B3 domain-containing protein {ECO:0000313|EMBL:EMT09782.1, ECO:0000313|EnsemblPlants:EMT09782} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_16402 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MGLEPISNFSRSCGSLYNYTEFGGASCQDEFQVLDLLHCWLVERSDWNAGCTLALEQQHC
NPGAGIFDNPVHGTGLAASQMEKLCDCCKRYADHLDEKMKCFRRHMGADFRHGMIIPKKF
IDNFGGMISRTIELESSNGNMYVFEVSKRMGNTVLHRGWQAFIDEHHIEENDSLLFRHIE
KSRFEILVLDSDDCEKVFFCPGINIVSNVEERGADSVNISNSSRDYATRSSGSKRLCTGE
DTENENTDAIYSSSEDSEEGTEDIPSEHESSFELDDGHTPSRQDYVLARGRTLSRVQDEK
VTTLIQDVGAEIPVFVAVMKPSNVKSQTSALVIPKGYAVEHFPPKSQTVTLQRPGKSKKW
HPRFHIRKDKHGSILCGPGWFDFVRDTRVQVGDICIFERMMKKGTGRTFSSLRVHLLRKS
MLHSGGSGTGPKRVSLTHGKTRVNSATPKGARTTDGRTRAKATSTASVRKEPGDEMFPGG
NAPSSVHSHGHEARQGPVESNKSRGPRKRPYIISSTACLTREQEMNVDKRARSLQSDVPI
YASVMNKSSVGDNSLYAVTICRKYAAEYLPAGAQTVTLLRAEKSKTWEVKVNPRIGNAKM
LKGGWREFAHDNHLKLKDICLFQLMTDQRKLTMMVDIIRHNEKR
Download sequence
Identical sequences M8AZ83
EMT09782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]