SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8B028 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8B028
Domain Number 1 Region: 226-425
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.23e-41
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 
Domain Number 2 Region: 454-578
Classification Level Classification E-value
Superfamily PapD-like 7.85e-18
Family MSP-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M8B028
Sequence length 583
Comment (tr|M8B028|M8B028_AEGTA) Cysteine-rich receptor-like protein kinase 26 {ECO:0000313|EMBL:EMT07331.1, ECO:0000313|EnsemblPlants:EMT07331} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_21242 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MASIIIRTTIIQDNCPDIIVLDLAPNRKCSSKSTYKLCLQDIQTQPRNRPFQVSHQVKAL
LKQLWKQKLMDPREDFSLEIASESPSNRSPDVIVFSREGAHSQIREALLQLIFLLMVLRS
ILMILLGAQKFQCVQQTHILTYLYGWFIGLLKTFKIKEQAIRESGEQKQANQQLVTSSSL
DLKVAALGWVPHRQGENNTIISFYLSPEKFVEHKGELIRAKAMEGVLCFEYMQRGSLEKY
IGDESCKLDWRTCYEIIKGTCEGLNHLHMQKNRIFHLDMKPANILLDNSMAPKIADLGLS
KLVSSTITYKTEVKKGTYGYMPPEYINNGFISDKFDVSSLGVIIIKIVARNTGHVSCFEM
SQEEFIELVRKVSKYWKEKMQAVSGYSSHEIYILQVRRCTEIALRCISKDRKERPNIDEI
VLELEELEVETKKNALPFDGSKYLILKRSCATNDVAVDPALELRFLFEPRKEVSCCLQLT
NKTDGFLAFNIKVNKNKYRAQPSISTMPPCSKCYVIVTLRPQGAAPPNMQCHDMLLVQST
SISEQLASEDTQISYQEVFKTTLAEKVVDEVKLPIVYVALLDG
Download sequence
Identical sequences M8B028
EMT07331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]