SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8B3B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8B3B4
Domain Number 1 Region: 31-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000192
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M8B3B4
Sequence length 128
Comment (tr|M8B3B4|M8B3B4_AEGTA) Uncharacterized protein {ECO:0000313|EMBL:EMT11222.1, ECO:0000313|EnsemblPlants:EMT11222} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_02838 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MRICTRVEEKESKDAEMQFFDPMVIPCGARRDFLEKFKVPVDATITFQCTLMKMLTVQKF
NCLVTNDTNRTYFGCPGWKALANAYKMEAGERATFYLDYDRDEIMVYYKLAGSDDGSLTP
DYDPDFVR
Download sequence
Identical sequences M8B3B4
EMT11222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]