SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8B3I2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8B3I2
Domain Number 1 Region: 33-108
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-28
Family B3 DNA binding domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M8B3I2
Sequence length 586
Comment (tr|M8B3I2|M8B3I2_AEGTA) Auxin response factor {ECO:0000256|RuleBase:RU004561} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_06493 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MEQYPCELANKMFRQNVRESASEEGEDEMAGGDGEKKPRMPHMFCKTLTASDTSTHGGFS
VPRRAAEDCFAPLDYKQVRPSQELVAKDLHGTQWRFRHIYRGERGDDGELRLGVRRAVQL
RNEALFRAVNSNESKLHTLSAVASSLENRSIFHVCFDPRSGASEFIVPYWRFSKSLNHPF
SIGMRFKDSNDSDDANERSTGLISGISEVDPIRWPGSKWRCLQYFRDQVRWDDGNHCNHQ
RRVSPWEIERIGGSIQVNDCLSASSSKRAKLYFPQGNLDAPVTDGNDFPDPVETGSFHRV
LQGQELLMGSRAQGAARSRSPDVAKFRPPDHQRFSANAGSYMPQQSPAEFPYHSSGFGES
LGFPEVLQGQEMSRALRFYSQGSAFDARAQHGPFGYAQRSAAPGGLSPAAQGYALGQFTP
SSAAAKVSSPSSVLMFNQATVPQFDLEGRTSGYRGAYGGQCPPGIEMVRETEEAWPCAQR
RTPSVTGTGCRRFEEWIMASTPARADGGRPRSAAAGDVVGRRSCRLVGVSLTDQKGLGGA
GEGAAKEGDAADEAVEGADPRGLDLFGRGHPAPAALHAIVAAPLGM
Download sequence
Identical sequences M8B3I2
EMT08561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]