SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8BAS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8BAS6
Domain Number 1 Region: 112-214
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000106
Family B3 DNA binding domain 0.023
Further Details:      
 
Domain Number 2 Region: 715-796
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000118
Family PB1 domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M8BAS6
Sequence length 858
Comment (tr|M8BAS6|M8BAS6_AEGTA) Auxin-responsive protein {ECO:0000256|RuleBase:RU004549} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_30848 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MRLSSPAGAVLPAQAPPSPEVAEEHKCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQ
VAASTNKEIESQIPNYPNLPPQLICQLHNVTMHADAETDEVYAQMTLQPLNPDFTMQPPA
QELFAKDLHGNEWKFRHIFRGNNVKHDSFCLLNFPPVKVSQSGIFSLQAGVSLNDNNQLL
LGIRRATRPQTVMPSSVLSSDSMHIGLLAAAAHAASTNSRFTIFYNPRASPCEFVIPLAK
YVKAVYHTRISVGMRFRMLFETEESSVRRYMGTITGISDLDAVRWPNSHWRSVKVGWDES
TAGERQPRVSLWEIEPLTTFPMYPTPFPLRLKRPWPTGLPSLHGGKDDDLTSSLMWLRDS
ANPGFQSLNFGGAGMNPWMQPRLDASLLGLQPDIYQTMAAAAFQDPTKMSPTMLQFQQPQ
NMVGRATPLLQSQILQQMQPQFQQQSYLQNMNGTTIQGQAHSEFLQQQLQRCQSFNEQKP
QLLQQQESNQQQSQGMQVPQHQHMQQQKNMANYQPAYSQLSPGPQSSPAALQTASPFSQP
QSFSDTNMSSLSPSGAPTMHNTLGPFSSETASHLSMSRPTAVPVPDSWSSKRVAVESLIP
SRPQSTPHMEQLSSTPPSIPQSSALAPLPGRGCLVDQDGSSDPQNHLLFGVNIDSHSLLM
QGGLHDENDSTAIPYSTSNFLSPSQHDFSLDQTLNSSGCLDESGYVPCSHTPDQVNQPPA
TFVKVYKSGTYGRSLDITKFSNYHELRRELGRLFGLEGQLEDPMRSGWQLVFVDREEDVL
LVGDDPWQEFVNSVSCIKILSPQEVQQMGKQGLELLSSAPGKRLGGGGGSSCDDYASRQE
SRSLSTGIASVGSVEVEF
Download sequence
Identical sequences M8BAS6
EMT11111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]