SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8BD27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M8BD27
Domain Number - Region: 7-43
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00196
Family B3 DNA binding domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M8BD27
Sequence length 51
Comment (tr|M8BD27|M8BD27_AEGTA) Uncharacterized protein {ECO:0000313|EMBL:EMT04668.1, ECO:0000313|EnsemblPlants:EMT04668} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_04433 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MARFIKGVDNRATLTKNWSNFFHKANMKKGCAYAFVFKCMSKGLCMTVYSI
Download sequence
Identical sequences M8BD27
EMT04668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]