SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8BMF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8BMF0
Domain Number 1 Region: 115-209
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.65e-16
Family B3 DNA binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M8BMF0
Sequence length 217
Comment (tr|M8BMF0|M8BMF0_AEGTA) B3 domain-containing protein {ECO:0000313|EMBL:EMT26160.1, ECO:0000313|EnsemblPlants:EMT26160} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_01230 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MAEPNSCEEQCRRQVEENKRKLEELRLHRLSVAVREAAVKPKPTKLPRRCRDAPTRLSGR
VAGLPEQPDYRDRKIRGGAYVDRRQLPPDDVYATDEASAYALTKAEELKSQLCFDHPSFV
KPICYKTATASCLRIPQLFKEWYLPWCNEMIYLVDEQDVEFHLPYYALSGSIGTGWKMFA
ISHNLADGDCLVFQQVQKTKFKVYIIRASSYYEKDHC
Download sequence
Identical sequences M8BMF0
EMT26160 XP_020192155.1.58150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]