SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8BR77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8BR77
Domain Number 1 Region: 15-82
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000235
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M8BR77
Sequence length 172
Comment (tr|M8BR77|M8BR77_AEGTA) B3 domain-containing protein {ECO:0000313|EMBL:EMT09249.1, ECO:0000313|EnsemblPlants:EMT09249} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_23566 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MMFENLWLANNIRERIADEVKLEVPDSKTSNIRVSKEGNDLVFQSGWETFASAYELEQGD
ILLFEYSGSSRFDVRIFDQSCCEKELSCVTMNNTSCVNERDMSQDNHMQSPRNESEVTST
KLFSVYKRKGDCTGGNYVPVYLEGDGISNQNLKNHDLVVKSTYDYGMFMALG
Download sequence
Identical sequences M8BR77
EMT09249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]