SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8BUJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8BUJ8
Domain Number 1 Region: 130-221
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000128
Family B3 DNA binding domain 0.014
Further Details:      
 
Weak hits

Sequence:  M8BUJ8
Domain Number - Region: 7-32
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0562
Family Toll/Interleukin receptor TIR domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M8BUJ8
Sequence length 319
Comment (tr|M8BUJ8|M8BUJ8_AEGTA) Uncharacterized protein {ECO:0000313|EMBL:EMT25624.1, ECO:0000313|EnsemblPlants:EMT25624} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_04994 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MARRSDVRCVVVASPEAVRSIWCLNALVDVQPLRYRTNDEAICGPSAEVWLERRAVPLSK
SRSSSRAAGASKKRKTRKELPDRLFWYGMKSTSAAAAVGPGPDDLSLKSIGVVGVSLHEI
LKNLNASAPVRIYGKLLWKSDRLLHQSRLLMSCKKWKQHGLDDVLTVEEKQLLQKQIKVD
MKAYDRNGNSYDLAFKKLDCNGAYRLIAGWGKFLKANNLHVEPKAKPKELEPAMVELWAF
RSPALHVSVTDNADNPLGLVVVHYRGGDAPHAEAAIDEIRASLPGAAVDAPHDDDDAVAA
IEADGGGEAVDAPAEADAE
Download sequence
Identical sequences M8BUJ8
EMT25624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]