SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8BW70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8BW70
Domain Number 1 Region: 73-169
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.09e-22
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M8BW70
Sequence length 230
Comment (tr|M8BW70|M8BW70_AEGTA) Uncharacterized protein {ECO:0000313|EMBL:EMT07173.1, ECO:0000313|EnsemblPlants:EMT07173} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_43744 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MQGVTPLAVVEALSLKLGPGVVVGPAGTAGPPPGAAATQQRPGRAAASDKQRQQGARTPA
AAPAAGDKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQ
VWSMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVRAQQD
LAKHKNGSPEKGGASDAKAGAEDGGCKEKSPHGVRRRQEAASMNQMAVSI
Download sequence
Identical sequences M8BW70
EMT07173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]