SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8C007 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8C007
Domain Number 1 Region: 198-292
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000051
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M8C007
Sequence length 301
Comment (tr|M8C007|M8C007_AEGTA) Uncharacterized protein {ECO:0000313|EMBL:EMT08528.1, ECO:0000313|EnsemblPlants:EMT08528} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_24446 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MEVRSPGRKSRTWDAWGSRRQRLLCPTLPRRSSKPARSRLILTRVVKPMDKRLFDGERIY
ARGDYLKCARILYIFHQALFLDAMLEDTVAPKIYGCVKQEEVDTANDTSGGQITHDEPLC
RKHNKRYEYIHRPRKASSIQKFKGKKIHLKPGKYILRGEPCKHYLDEFSRHVVWGNIVRL
YNHNGRAVRKIIRSTTTPNNYYVCHMTETFATQGKRMYFNVHFSMGSLFPHMDAGHGELP
ITTGDGTTTVTARFIKGVDKRATITKGWSDFFRRTHMNEGQAYAFGFKCTSKGLHLIVYS
I
Download sequence
Identical sequences M8C007
EMT08528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]